PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00118049001
Common NameGSBRNA2T00118049001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 353aa    MW: 40134.1 Da    PI: 5.8018
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00118049001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.82.1e-3247100255
              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          prl+Wt+eLH+rFveav+qLGG++kAtPk+++++m+++gLtl+h+kSHLQkYRl
  GSBRNA2T00118049001  47 PRLKWTCELHHRFVEAVNQLGGPNKATPKSLMKAMEIPGLTLYHLKSHLQKYRL 100
                          9****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.4E-2845100IPR009057Homeodomain-like
TIGRFAMsTIGR015576.6E-2246101IPR006447Myb domain, plants
SuperFamilySSF466893.05E-1546100IPR009057Homeodomain-like
PfamPF002497.3E-74899IPR001005SANT/Myb domain
PfamPF143795.1E-16149196IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MWAAAPETED RRPLHGEPHG DVLAASMLTS VSSLDHLGET RILDANPRLK WTCELHHRFV  60
EAVNQLGGPN KATPKSLMKA MEIPGLTLYH LKSHLQKYRL GKSLKFDDNR LEVSSALETQ  120
EAESGNYSRD FKGSVNEENN HPANDRSLKI TESLQLQTEV QKKLHEHIEI VHRNLQVKVE  180
AQGKYLQSVL IKAQQTLAGY TSSTLGMDFA RTELSRFASL VNPSSSFSEL TQVEEYEEEA  240
EDAQESFLYR KKTETRGIRL LRCSVESSLA SSERSETKLN NDNDERQLVE LPLMEIKSEV  300
MTDKKKRNHN DVVCMECQLL KKIDFEVDDD EQELKLSLNS YKKKYGDVPD RT*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00118049001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013695683.10.0PREDICTED: uncharacterized protein LOC106399776
TrEMBLA0A078ESS10.0A0A078ESS1_BRANA; BnaC06g25290D protein
STRINGBra003993.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38782759
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69580.21e-126G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]